SEC11C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179339

Catalog No. NBP179339

Description

SEC11C Polyclonal specifically detects SEC11C in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SEC11C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4, Microsomal signal peptidase 21 kDa subunit, SEC11 homolog C, SEC11 homolog C (S. cerevisiae), SEC11L3, SEC11-like protein 3, signal peptidase complex catalytic subunit SEC11C, SPase 21 kDa subunit, SPC21SEC11-like 3 (S. cerevisiae), SPCS4CSEC11-like 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90701
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_079744
• Gene Symbols: SEC11C
• Immunogen: The immunogen for this antibody is Sec11c. Peptide sequence VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Goat: 100%; Human: 100%; Rat: 100%; Xenopus: 92%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG