Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC11C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SEC11C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SEC11C Polyclonal specifically detects SEC11C in Mouse samples. It is validated for Western Blot.Specifications
SEC11C | |
Polyclonal | |
Rabbit | |
NP_079744 | |
90701 | |
The immunogen for this antibody is Sec11c. Peptide sequence VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 3.4, Microsomal signal peptidase 21 kDa subunit, SEC11 homolog C, SEC11 homolog C (S. cerevisiae), SEC11L3, SEC11-like protein 3, signal peptidase complex catalytic subunit SEC11C, SPase 21 kDa subunit, SPC21SEC11-like 3 (S. cerevisiae), SPCS4CSEC11-like 3 | |
SEC11C | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title