SEC11C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18077425UL

Catalog No. NB407402

Description

SEC11C Polyclonal specifically detects SEC11C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SEC11C
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: EC 3.4, Microsomal signal peptidase 21 kDa subunit, SEC11 homolog C, SEC11 homolog C (S. cerevisiae), SEC11L3, SEC11-like protein 3, signal peptidase complex catalytic subunit SEC11C, SPase 21 kDa subunit, SPC21SEC11-like 3 (S. cerevisiae), SPCS4CSEC11-like 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90701
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SEC11C
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only