Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301327

SEC22L2 Antibody, Novus Biologicals™
SDP

Catalog No. NB301327 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301327 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301327 Supplier Novus Biologicals Supplier No. NBP325125
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SEC22L2 Polyclonal antibody specifically detects SEC22L2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen SEC22L2
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias sec22 homolog, SEC22 vesicle trafficking protein homolog A (S. cerevisiae), SEC22 vesicle trafficking protein-like 2, SEC22 vesicle trafficking protein-like 2 (S. cerevisiae), SEC22 vesicle-trafficking protein-like 2, SEC22L2SEC22 vesicle-trafficking protein homolog A, vesicle-trafficking protein SEC22a
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein SEC22L2 using the following amino acid sequence: YNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAH
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26984
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.