SEC23IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25836125UL

Catalog No. NB403228

Description

SEC23IP Polyclonal specifically detects SEC23IP in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.

Specifications

• Antigen: SEC23IP
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: P125, P125A, SEC23 interacting protein, SEC23-interacting protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SEC23IP
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM
• Quantity: 25 μL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 11196
• Target Species: Human
• Isotype: IgG

For Research Use Only