Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC23IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SEC23IP |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SEC23IP Polyclonal specifically detects SEC23IP in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
SEC23IP | |
Polyclonal | |
Rabbit | |
Golgi Apparatus Markers | |
P125, P125A, SEC23 interacting protein, SEC23-interacting protein | |
SEC23IP | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
Unconjugated | |
RUO | |
Human | |
11196 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title