Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC31A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179575
Description
SEC31A Polyclonal specifically detects SEC31A in Rat samples. It is validated for Western Blot.Specifications
SEC31A | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ABP125ABP130KIAA0905Web1-like protein, DKFZp686N07171, HSPC334, MGC90305, protein transport protein Sec31A, protein-transport protein SEC31, SEC31 homolog A (S. cerevisiae), SEC31L1, SEC31-like 1, SEC31-like 1 (S. cerevisiae), SEC31-like protein 1, SEC31-related protein A, yeast Sec31p homolog | |
Rabbit | |
136 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_148981 | |
SEC31A | |
Synthetic peptide directed towards the N terminal of human Sec31aThe immunogen for this antibody is Sec31a. Peptide sequence DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM. | |
Affinity purified | |
RUO | |
22872 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction