SEC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155109

Catalog No. NBP155109

Description

SEC6 Polyclonal specifically detects SEC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SEC6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: exocyst complex component 3, Exocyst complex component Sec6, Sec 6 homolog, SEC6, SEC6L1, SEC6-like 1, SEC6-like 1 (S. cerevisiae), Sec6p
• Host Species: Rabbit
• Molecular Weight of Antigen: 85 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: Q6P2E8
• Gene Symbols: EXOC3
• Immunogen: Synthetic peptides corresponding to EXOC3(exocyst complex component 3) The peptide sequence was selected from the middle region of EXOC3. Peptide sequence LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11336
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG