Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | SEC6 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155109
|
Novus Biologicals
NBP155109 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
SEC6 Polyclonal specifically detects SEC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SEC6 | |
Unconjugated | |
RUO | |
exocyst complex component 3, Exocyst complex component Sec6, Sec 6 homolog, SEC6, SEC6L1, SEC6-like 1, SEC6-like 1 (S. cerevisiae), Sec6p | |
EXOC3 | |
IgG | |
85 kDa |
Polyclonal | |
Rabbit | |
Q6P2E8 | |
11336 | |
Synthetic peptides corresponding to EXOC3(exocyst complex component 3) The peptide sequence was selected from the middle region of EXOC3. Peptide sequence LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title