Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEC61A Rabbit anti-Human, Mouse, Rat, Clone: ARC2323, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier: Novus Biologicals NBP31659920UL

View more versions of this product

Catalog No. NB168290

$205.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

This item is not returnable. View return policy

Description

SEC61A Monoclonal antibody specifically detects SEC61A in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

Antigen	SEC61A
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Applications	Western Blot
Clone	ARC2323
Dilution	Western Blot 1:500 - 1:2000
Gene Alias	HSEC61, protein transport protein SEC61 alpha subunit, protein transport protein Sec61 subunit alpha, protein transport protein Sec61 subunit alpha isoform 1, SEC61, Sec61 alpha 1 subunit (S. cerevisiae), Sec61 alpha-1, sec61 homolog, SEC61A
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SEC61A (Q9H9S3). Sequence: SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA
Quantity	20 μg
Research Discipline	Membrane Trafficking and Chaperones
Gene ID (Entrez)	29927
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

SEC61A Rabbit anti-Human, Mouse, Rat, Clone: ARC2323, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions