Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SEC61A Rabbit anti-Human, Mouse, Rat, Clone: ARC2323, Novus Biologicals™

SEC61A Rabbit anti-Human, Mouse, Rat, Clone: ARC2323, Novus Biologicals™
SDP

Catalog No. NB168290 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168290 20 μg
NB168289 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB168290 Supplier Novus Biologicals Supplier No. NBP31659920UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

SEC61A Monoclonal antibody specifically detects SEC61A in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

Antigen SEC61A
Applications Western Blot
Classification Monoclonal
Clone ARC2323
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias HSEC61, protein transport protein SEC61 alpha subunit, protein transport protein Sec61 subunit alpha, protein transport protein Sec61 subunit alpha isoform 1, SEC61, Sec61 alpha 1 subunit (S. cerevisiae), Sec61 alpha-1, sec61 homolog, SEC61A
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SEC61A (Q9H9S3). Sequence: SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 29927
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.