Learn More
Description
Specifications
Specifications
| Antigen | SEC61B |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | protein translocation complex beta, protein transport protein SEC61 beta subunit, protein transport protein Sec61 subunit beta, Sec61 beta subunit, Sec61 complex, beta subunit, SEC61B |
| Gene Symbols | SEC61B |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
