Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SEMA3D Antibody, Novus Biologicals™

SEMA3D Antibody, Novus Biologicals™
SDP

Catalog No. NBP15950520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15950520 20 μL
NBP159505 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15950520 Supplier Novus Biologicals Supplier No. NBP15950520UL

Description

Rabbit Polyclonal Antibody

SEMA3D Polyclonal specifically detects SEMA3D in Human samples. It is validated for Western Blot.

Specifications

Antigen SEMA3D
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95025
Gene Alias (semaphorin) 3D, coll-2, collapsin 2, MGC39708, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, semaphorin-3D, Sema-Z2
Gene Symbols SEMA3D
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SEMA3D(sema domain, immunoglobulin domain, short basic domain, secreted, 3D) The peptide sequence was selected from the middle region of SEMA3D. Peptide sequence LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLL
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 223117
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.