Semaphorin 3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256804

Catalog No. NBP256804

Description

Semaphorin 3A Polyclonal specifically detects Semaphorin 3A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Semaphorin 3A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: (semaphorin) 3A, coll-1, collapsin 1, Hsema-I, Hsema-III, MGC133243, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, Sema III, SEMA1, SEMAD, SEMAIII, SEMAL, semaphorin D, Semaphorin III, semaphorin L, semaphorin-3A, SemD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SEMA3A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 10371
• Target Species: Human
• Isotype: IgG

For Research Use Only