Semaphorin 6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169281

Catalog No. NBP169281

Description

Semaphorin 6A Polyclonal specifically detects Semaphorin 6A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Semaphorin 6A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA1368HT018, SEMA, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A, Sema VIA, SEMA6A1, SEMA6A-1, semaphorin 6A-1, Semaphorin VIA, semaphorin-6A, Semaphorin-6A-1, SEMAQ, VIA
• Host Species: Rabbit
• Molecular Weight of Antigen: 114 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 57556
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H2E6
• Gene Symbols: SEMA6A
• Immunogen: Synthetic peptides corresponding to SEMA6A(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A) The peptide sequence was selected from the middle region of SEMA6A. Peptide sequence ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only