Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SEPHS1 Antibody, Novus Biologicals™

SEPHS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155167 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155167 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155167 Supplier Novus Biologicals Supplier No. NBP155167
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SEPHS1 Polyclonal specifically detects SEPHS1 in Human samples. It is validated for Western Blot.

Specifications

Antigen SEPHS1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P49903
Gene Alias EC 2.7.9.3, MGC4980, SELD, Selenium donor protein 1, Selenophosphate synthase 1, selenophosphate synthetase 1, selenophosphate synthetase 1 +E9a, selenophosphate synthetase 1 delta E2, selenophosphate synthetase 1 delta E8, selenophosphate synthetase 1 major, SPS1selenophosphate synthetase 1 +E9, water dikinase 1
Gene Symbols SEPHS1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SEPHS1(selenophosphate synthetase 1) The peptide sequence was selected from the C terminal of SEPHS1 (NP_036379). Peptide sequence PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS.
Molecular Weight of Antigen 43 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 22929
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.