Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEPN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16905820UL
Description
SEPN1 Polyclonal specifically detects SEPN1 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SEPN1 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500 | |
D3Z5N3 | |
SEPN1 | |
Synthetic peptides corresponding to Sepn1 (selenoprotein N, 1) The peptide sequence was selected from the C terminal of Sepn1. Peptide sequence VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR. | |
Affinity Purified | |
RUO | |
57190 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ24021, rigid spine muscular dystrophy 1, RSMD1, RSS, selenoprotein N, selenoprotein N, 1, SelN, SELNMDRS1 | |
Rabbit | |
62 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction