Septin-11 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP158144	100 μL

Catalog No. NBP158144 Supplier Novus Biologicals Supplier No. NBP158144

Description

Rabbit Polyclonal Antibody

Septin-11 Polyclonal antibody specifically detects Septin-11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Septin-11
• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9NVA2
• Gene Alias: FLJ10849, septin 11, septin-11
• Gene Symbols: 43354
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to SEPT11(septin 11) The peptide sequence was selected from the N terminal of 40432. Peptide sequence MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle and Replication
• Primary or Secondary: Primary
• Gene ID (Entrez): 55752
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Rat: 100%; Crab-eating macaque: 100%; Sumatran orangutan: 100%; Mouse: 100%; Human: 100%; Zebra finch: 78%;.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only