Learn More
Description
Specifications
Specifications
| Antigen | SERF1A |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | FAM2B, h4F5, H4F5small EDRK-rich factor 1,4F5, Protein 4F5, SERF1, SMA modifier 1, small EDRK-rich factor 1A (telomeric), SMAM1FAM2ASERF1B, spinal muscular atrophy-related gene H4F5 |
| Gene Symbols | SERF1A |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
