Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SERINC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | SERINC2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16010220
![]() |
Novus Biologicals
NBP16010220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP160102
![]() |
Novus Biologicals
NBP160102 |
100 μL |
Each for $499.50
|
|
|||||
Description
SERINC2 Polyclonal specifically detects SERINC2 in Human samples. It is validated for Western Blot.Specifications
SERINC2 | |
Polyclonal | |
Rabbit | |
Human | |
347735 | |
Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FKSG84, PRO0899, serine incorporator 2, TDE2, TDE2L | |
SERINC2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title