SERINC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213296

Catalog No. NBP213296

Description

SERINC3 Polyclonal specifically detects SERINC3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SERINC3
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: AIGP1, DIFF33tumor differentially expressed 1, placental transmembrane protein (mouse testicular tumor differentiallyexpressed), SBBI99, serine incorporator 3, TDE, TDE1Tumor differentially expressed protein 1, TMS-1, transmembrane protein SBBI99, tumour differentially expressed 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10955
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SERINC3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only