Serine Dehydratase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156667

Catalog No. NBP156667

Description

Serine Dehydratase Polyclonal specifically detects Serine Dehydratase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Serine Dehydratase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 4.3.1.17, EC 4.3.1.19, L-serine ammonia-lyase, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDHL-serine dehydratase, serine dehydratase, TDH
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P20132
• Gene Symbols: SDS
• Immunogen: Synthetic peptides corresponding to SDS(serine dehydratase) The peptide sequence was selected from the N terminal of SDS (NP_006834) Peptide sequence AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10993
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.