Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Serine Dehydratase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156667
Description
Serine Dehydratase Polyclonal specifically detects Serine Dehydratase in Human samples. It is validated for Western Blot.Specifications
Serine Dehydratase | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 4.3.1.17, EC 4.3.1.19, L-serine ammonia-lyase, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDHL-serine dehydratase, serine dehydratase, TDH | |
Rabbit | |
35 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%. | |
Human, Mouse, Rat, Pig, Bovine, Equine, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P20132 | |
SDS | |
Synthetic peptides corresponding to SDS(serine dehydratase) The peptide sequence was selected from the N terminal of SDS (NP_006834) Peptide sequence AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA. | |
Affinity purified | |
RUO | |
10993 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction