Serine racemase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25890325UL

Catalog No. NB393220

Description

Serine racemase Polyclonal specifically detects Serine racemase in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Serine racemase
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: D-serine ammonia-lyase, D-serine dehydratase, EC 4.3.1.17, EC 4.3.1.18, EC 5.1.1.18, ILV1, ISO1, L-serine ammonia-lyase, L-serine dehydratase, serine racemase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63826
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SRR
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only