SERPINB10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23887625UL

Catalog No. NB436074

Description

SERPINB10 Polyclonal specifically detects SERPINB10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SERPINB10
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P48595
• Gene Symbols: SERPINB10
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: bomapin, Peptidase inhibitor 10, PI-10, PI10protease inhibitor 10 (ovalbumin type, bomapin), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 10, serpin B10, serpin peptidase inhibitor, clade B (ovalbumin), member 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5273
• Target Species: Human
• Isotype: IgG