SERPINB4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157078

Catalog No. NBP157078

Description

SERPINB4 Polyclonal specifically detects SERPINB4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SERPINB4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Leupin, Peptidase inhibitor 11, PI-11, PI11clade B (ovalbumin), member 4, serpin peptidase inhibitor, clade B (ovalbumin), member 4, squamous cell carcinoma antigen 1, Squamous cell carcinoma antigen 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 6318
• Target Species: Human, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P48594
• Gene Symbols: SERPINB4
• Immunogen: Synthetic peptides corresponding to SERPINB4 (serpin peptidase inhibitor, clade B (ovalbumin), member 4) The peptide sequence was selected from the N terminal of SERPINB4. Peptide sequence TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only