SETD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180045

Catalog No. NBP180045

Description

SETD4 Polyclonal specifically detects SETD4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SETD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SETD4
• Immunogen: Synthetic peptide directed towards the C terminal of human SETD4. Peptide sequence VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54093
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG