Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18004520UL
Description
SETD4 Polyclonal specifically detects SETD4 in Human, Mouse samples. It is validated for Western Blot.Specifications
SETD4 | |
Polyclonal | |
Western Blot 1:1000 | |
C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4 | |
Rabbit | |
32 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
SETD4 | |
Synthetic peptide directed towards the C terminal of human SETD4. Peptide sequence VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH. | |
Affinity Purified | |
RUO | |
54093 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction