Learn More
Description
Specifications
Specifications
| Antigen | SETD4 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:1000 |
| Formulation | PBS & 2% Sucrose. with No Preservative |
| Gene Alias | C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4 |
| Gene Symbols | SETD4 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptide directed towards the C terminal of human SETD4. Peptide sequence VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
