Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255772
Description
SETD8 Polyclonal specifically detects SETD8 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SETD8 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
H4-K20-HMTase SETD8, H4K20-specific histone methyltransferase splice variant Set8b, Histone-lysine N-methyltransferase SETD8, KMT5A, KMT5A SET domain-containing protein 8, Lysine N-methyltransferase 5A, PR/SET domain containing protein 8, PR/SET domain-containing protein 07, PR/SET07, PRSET7, PR-Set7EC 2.1.1.43, SET domain containing (lysine methyltransferase) 8, SET07SET8H4-K20-specific histone methyltransferase, SET8 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
KMT5A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK | |
100 μL | |
Cell Cycle and Replication, Epigenetics | |
387893 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction