Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SETD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	SETD8
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP255772 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP255772	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403879 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25577225UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SETD8 Polyclonal specifically detects SETD8 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	SETD8
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, Epigenetics
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	387893
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	H4-K20-HMTase SETD8, H4K20-specific histone methyltransferase splice variant Set8b, Histone-lysine N-methyltransferase SETD8, KMT5A, KMT5A SET domain-containing protein 8, Lysine N-methyltransferase 5A, PR/SET domain containing protein 8, PR/SET domain-containing protein 07, PR/SET07, PRSET7, PR-Set7EC 2.1.1.43, SET domain containing (lysine methyltransferase) 8, SET07SET8H4-K20-specific histone methyltransferase, SET8
Gene Symbols	KMT5A
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SETD8 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents