Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C5orf35 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SETD9 Polyclonal specifically detects SETD9 in Human samples. It is validated for Western Blot.Specifications
C5orf35 | |
Polyclonal | |
Rabbit | |
Human | |
C5orf35, chromosome 5 open reading frame 35, hypothetical protein LOC133383, MGC33648, SET domain containing 9 | |
SETD9 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8NE22 | |
133383 | |
Synthetic peptides corresponding to C5ORF35 The peptide sequence was selected from the N terminal of C5ORF35. Peptide sequence QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title