Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETDB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25667825UL
Description
SETDB1 Polyclonal specifically detects SETDB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SETDB1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
ERG-associated protein with SET domain, ESETEC 2.1.1.43, H3-K9-HMTase 4, Histone H3-K9 methyltransferase 4, histone-lysine N-methyltransferase SETDB1, histone-lysine N-methyltransferase, H3lysine-9 specific 4, KG1T, KIAA0067H3-K9-HMTase4, KMT1EERG-associated protein with a SET domain, ESET, Lysine N-methyltransferase 1E, SET domain bifurcated 1, SET domain, bifurcated 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SETDB1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY | |
25 μL | |
Epigenetics, Transcription Factors and Regulators | |
9869 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction