SETDB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256678

Catalog No. NBP256678

Description

SETDB1 Polyclonal specifically detects SETDB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SETDB1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ERG-associated protein with SET domain, ESETEC 2.1.1.43, H3-K9-HMTase 4, Histone H3-K9 methyltransferase 4, histone-lysine N-methyltransferase SETDB1, histone-lysine N-methyltransferase, H3lysine-9 specific 4, KG1T, KIAA0067H3-K9-HMTase4, KMT1EERG-associated protein with a SET domain, ESET, Lysine N-methyltransferase 1E, SET domain bifurcated 1, SET domain, bifurcated 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SETDB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY
• Quantity: 100 μL
• Research Discipline: Epigenetics, Transcription Factors and Regulators
• Gene ID (Entrez): 9869
• Target Species: Human
• Isotype: IgG

For Research Use Only