SF3A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310539100UL

Catalog No. NB125979

Description

SF3A1 Polyclonal specifically detects SF3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SF3A1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Alias: pre-mRNA processing 21, pre-mRNA splicing factor SF3a (120 kDa subunit), Prp21, PRPF21, SAP 114, SAP114splicing factor 3a, subunit 1, 120kD, SF3a120, spliceosome associated protein 114, Spliceosome-associated protein 114, splicing factor 3 subunit 1, splicing factor 3A subunit 1, splicing factor 3a, subunit 1, 120kDa
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1 (NP_005868). Peptide sequence QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10291
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.