SFPQ Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP157458	100 μL

Catalog No. NBP157458 Supplier Novus Biologicals Supplier No. NBP157458

Description

Rabbit Polyclonal Antibody

SFPQ Polyclonal specifically detects SFPQ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SFPQ
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P23246
• Gene Alias: 100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
• Gene Symbols: SFPQ
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to SFPQ (splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)) The peptide sequence was selected from the N terminal of SFPQ. Peptide sequence VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Primary or Secondary: Primary
• Gene ID (Entrez): 6421
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 78%; Rat: 78%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG

For Research Use Only