SFPQ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24887625UL

Catalog No. NB395951

Description

SFPQ Polyclonal antibody specifically detects SFPQ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: SFPQ
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
• Gene Alias: 100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK
• Quantity: 25 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6421
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified