SFPQ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB395951	Novus Biologicals NBP24887625UL	25 μL

Description

SFPQ Polyclonal antibody specifically detects SFPQ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: SFPQ
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene ID (Entrez): 6421
• Isotype: IgG
• Purification Method: Immunogen affinity purified

• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.