sFRP-3/FRZB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179552

Catalog No. NBP179552

Description

sFRP-3/FRZB Polyclonal specifically detects sFRP-3/FRZB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: sFRP-3/FRZB
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FIZ, FREOS1, Frezzled, Fritz, frizzled-related protein, Frizzled-related protein 1, FRP, FRP-3, FrzB-1, FRZB1sFRP-3, FRZB-PEN, FZRB, hFIZ, secreted frizzled-related protein 3, SFRP3frezzled, SRFP3frizzled homolog-related
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction, Stem Cells
• Gene ID (Entrez): 2487
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_001454
• Gene Symbols: FRZB
• Immunogen: Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.