Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
sFRP-3/FRZB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $560.50
Specifications
Antigen | sFRP-3/FRZB |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17955220
![]() |
Novus Biologicals
NBP17955220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179552
![]() |
Novus Biologicals
NBP179552 |
100 μL |
Each for $560.50
|
|
|||||
Description
sFRP-3/FRZB Polyclonal specifically detects sFRP-3/FRZB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
sFRP-3/FRZB | |
Polyclonal | |
Rabbit | |
NP_001454 | |
2487 | |
Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
FIZ, FREOS1, Frezzled, Fritz, frizzled-related protein, Frizzled-related protein 1, FRP, FRP-3, FrzB-1, FRZB1sFRP-3, FRZB-PEN, FZRB, hFIZ, secreted frizzled-related protein 3, SFRP3frezzled, SRFP3frizzled homolog-related | |
FRZB | |
IgG | |
36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title