Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. sFRP-3/FRZB Antibody, Novus Biologicals™

sFRP-3/FRZB Antibody, Novus Biologicals™
SDP

Catalog No. NBP17955220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17955220 20 μL
NBP179552 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17955220 Supplier Novus Biologicals Supplier No. NBP17955220UL

Description

Rabbit Polyclonal Antibody

sFRP-3/FRZB Polyclonal specifically detects sFRP-3/FRZB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen sFRP-3/FRZB
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001454
Gene Alias FIZ, FREOS1, Frezzled, Fritz, frizzled-related protein, Frizzled-related protein 1, FRP, FRP-3, FrzB-1, FRZB1sFRP-3, FRZB-PEN, FZRB, hFIZ, secreted frizzled-related protein 3, SFRP3frezzled, SRFP3frizzled homolog-related
Gene Symbols FRZB
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS.
Molecular Weight of Antigen 36 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2487
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.