Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SH2D1A Antibody, Novus Biologicals™
SDP

Catalog No. NBP179810 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179810 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179810 Supplier Novus Biologicals Supplier No. NBP179810
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SH2D1A Polyclonal specifically detects SH2D1A in Human samples. It is validated for Western Blot.

Specifications

Antigen SH2D1A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_002342
Gene Alias DSHPLYP, Duncan disease SH2-protein, EBVS, FLJ92177, IMD5, MTCP1, SAP/SH2D1A, SAPlymphoproliferative syndrome, SH2 domain containing 1A, SH2 domain-containing protein 1A, signaling lymphocyte activation molecule-associated protein, Signaling lymphocytic activation molecule-associated protein, SLAM associated protein/SH2 domain protein 1A, SLAM-associated protein, T cell signal transduction molecule SAP, T-cell signal transduction molecule SAP, XLPDFLJ18687, XLPSH2 domain protein 1A
Gene Symbols SH2D1A
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human SH2D1A. Peptide sequence YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL.
Molecular Weight of Antigen 14 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Immune System Diseases, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 4068
Test Specificity Expected identity based on immunogen sequence: Bovine: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.