SH2D1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179810

Catalog No. NBP179810

Description

SH2D1A Polyclonal specifically detects SH2D1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SH2D1A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DSHPLYP, Duncan disease SH2-protein, EBVS, FLJ92177, IMD5, MTCP1, SAP/SH2D1A, SAPlymphoproliferative syndrome, SH2 domain containing 1A, SH2 domain-containing protein 1A, signaling lymphocyte activation molecule-associated protein, Signaling lymphocytic activation molecule-associated protein, SLAM associated protein/SH2 domain protein 1A, SLAM-associated protein, T cell signal transduction molecule SAP, T-cell signal transduction molecule SAP, XLPDFLJ18687, XLPSH2 domain protein 1A
• Host Species: Rabbit
• Molecular Weight of Antigen: 14 kDa
• Quantity: 100 μL
• Research Discipline: Immune System Diseases, Immunology
• Gene ID (Entrez): 4068
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_002342
• Gene Symbols: SH2D1A
• Immunogen: Synthetic peptide directed towards the C terminal of human SH2D1A. Peptide sequence YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 86%.
• Target Species: Human, Rat, Pig, Bovine, Equine
• Isotype: IgG