Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SH2D1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SH2D1A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SH2D1A Polyclonal specifically detects SH2D1A in Human samples. It is validated for Western Blot.Specifications
SH2D1A | |
Polyclonal | |
Rabbit | |
Immune System Diseases, Immunology | |
DSHPLYP, Duncan disease SH2-protein, EBVS, FLJ92177, IMD5, MTCP1, SAP/SH2D1A, SAPlymphoproliferative syndrome, SH2 domain containing 1A, SH2 domain-containing protein 1A, signaling lymphocyte activation molecule-associated protein, Signaling lymphocytic activation molecule-associated protein, SLAM associated protein/SH2 domain protein 1A, SLAM-associated protein, T cell signal transduction molecule SAP, T-cell signal transduction molecule SAP, XLPDFLJ18687, XLPSH2 domain protein 1A | |
SH2D1A | |
IgG | |
14 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_002342 | |
4068 | |
Synthetic peptide directed towards the C terminal of human SH2D1A. Peptide sequence YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title