SH3BGRL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23360925UL

Catalog No. NB436819

Description

SH3BGRL Polyclonal specifically detects SH3BGRL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SH3BGRL
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: O75368
• Gene Symbols: SH3BGRL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MGC117402, SH3 domain binding glutamic acid-rich protein like, SH3 domain-binding glutamic acid-rich-like protein, SH3BGR, SH3-binding domain glutamic acid-rich protein like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6451
• Target Species: Human
• Isotype: IgG

For Research Use Only