SH3PX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180777

Catalog No. NBP180777

Description

SH3PX1 Polyclonal specifically detects SH3PX1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SH3PX1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MST155, MSTP155, Protein SDP1, SDP1, SH3 and PX domain-containing protein 1, SH3PX1WISP, SH3PXD3ASH3 and PX domain-containing protein SH3PX1, sorting nexin 9, sorting nexin-9, WiskSH3 and PX domain-containing protein 3A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51429
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.3mg/mL
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9Y5X1
• Gene Symbols: SNX9
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only