SH3RF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238841

Catalog No. NBP238841

Description

SH3RF2 Polyclonal specifically detects SH3RF2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SH3RF2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8TEC5
• Gene Symbols: SH3RF2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSE
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 153769
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 6.3.2, EC 6.3.2.-, Heart protein phosphatase 1-binding protein, HEPP1FLJ23654, MGC149788, MGC149789, putative E3 ubiquitin-protein ligase SH3RF2, RING finger protein 158, RNF158MGC90410, SH3 domain containing ring finger 2, SH3 domain-containing RING finger protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.