SHB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25822325UL

Catalog No. NB393563

Description

SHB Polyclonal specifically detects SHB in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SHB
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: bA3J10.2, RP11-3J10.8, SH2 domain-containing adapter protein B, SHB (Src homology 2 domain containing) adaptor protein B, SHB adaptor protein (a Src homology 2 protein), Src homology 2 domain containing adaptor protein B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6461
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SHB
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only