Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHFM3 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309354100UL
Description
SHFM3 Polyclonal specifically detects SHFM3 in Rat samples. It is validated for Western Blot.Specifications
SHFM3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DAC, Dactylin, F-box and WD repeat domain containing 4, F-box and WD-40 domain protein 4, F-box and WD-40 domain-containing protein 4, F-box/WD repeat protein 4, F-box/WD repeat-containing protein 4, Fbw4, FBW4split hand/foot malformation (ectrodactyly) type 3, FBWD4, SHFM3, SHSF3 | |
The immunogen is a synthetic peptide corresponding to a region of Rat (NP_001101070). Peptide sequence STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY | |
100 μg | |
Signal Transduction | |
6468 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Rat | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction