Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHFM3 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SHFM3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SHFM3 Polyclonal specifically detects SHFM3 in Rat samples. It is validated for Western Blot.Specifications
| SHFM3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 6468 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Rat | |
| DAC, Dactylin, F-box and WD repeat domain containing 4, F-box and WD-40 domain protein 4, F-box and WD-40 domain-containing protein 4, F-box/WD repeat protein 4, F-box/WD repeat-containing protein 4, Fbw4, FBW4split hand/foot malformation (ectrodactyly) type 3, FBWD4, SHFM3, SHSF3 | |
| The immunogen is a synthetic peptide corresponding to a region of Rat (NP_001101070). Peptide sequence STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title