Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHISA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15905320UL
Description
SHISA5 Polyclonal specifically detects SHISA5 in Human samples. It is validated for Western Blot.Specifications
SHISA5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8N114 | |
SHISA5 | |
Synthetic peptides corresponding to SCOTIN The peptide sequence was selected from the middle region of SCOTIN. Peptide sequence CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
protein shisa-5, Putative NF-kappa-B-activating protein 120, Scotin, SCOTINhShisa5, shisa homolog 5 (Xenopus laevis) | |
Rabbit | |
Affinity Purified | |
RUO | |
51246 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction