Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHISA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SHISA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159053
|
Novus Biologicals
NBP159053 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15905320
|
Novus Biologicals
NBP15905320UL |
20 μL | N/A | N/A | N/A | ||||
Description
SHISA5 Polyclonal specifically detects SHISA5 in Human samples. It is validated for Western Blot.Specifications
| SHISA5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| protein shisa-5, Putative NF-kappa-B-activating protein 120, Scotin, SCOTINhShisa5, shisa homolog 5 (Xenopus laevis) | |
| SHISA5 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N114 | |
| 51246 | |
| Synthetic peptides corresponding to SCOTIN The peptide sequence was selected from the middle region of SCOTIN. Peptide sequence CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title