Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHMT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15319220UL
Description
SHMT1 Polyclonal specifically detects SHMT1 in Human samples. It is validated for Western Blot.Specifications
SHMT1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
14 kDa protein, CSHMT, cytoplasmic serine hydroxymethyltransferase, Glycine hydroxymethyltransferase, MGC15229, MGC24556, serine hydroxymethyltransferase 1 (soluble), serine hydroxymethyltransferase, cytosolic, Serine methylase, SHMTEC 2.1.2.1 | |
Rabbit | |
53 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
SHMT1 | |
Synthetic peptides corresponding to SHMT1 (serine hydroxymethyltransferase 1 (soluble)) The peptide sequence was selected from the N terminal of SHMT1)(50ug). Peptide sequence NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG. | |
Affinity Purified | |
RUO | |
6470 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction