SHMT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153192

Catalog No. NBP153192

Description

SHMT1 Polyclonal specifically detects SHMT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SHMT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SHMT1
• Immunogen: Synthetic peptides corresponding to SHMT1 (serine hydroxymethyltransferase 1 (soluble)) The peptide sequence was selected from the N terminal of SHMT1)(50ug). Peptide sequence NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 14 kDa protein, CSHMT, cytoplasmic serine hydroxymethyltransferase, Glycine hydroxymethyltransferase, MGC15229, MGC24556, serine hydroxymethyltransferase 1 (soluble), serine hydroxymethyltransferase, cytosolic, Serine methylase, SHMTEC 2.1.2.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 6470
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
• Isotype: IgG